Products

Human CCL3, His Tag, E. coli

CCL3 is belonging to the CC chemokine family. CCL3 participates in activating and recruiting cells, such as lymphocytes, monocytes, and granulocytes during acute inflammation. In addition, CCL3 can enhance IFN-γ secretion from activated T cells and thus induces Th1 response, thereby to regulating leukocyte migration. It is reported that CCL3 is involved in susceptibility of HIV infection and disease progression of AIDS.
No. Size Price Qty Status
C01190-5UG 5 ug $108.00 Inquiry
C01190-20UG 20 ug $268.00 Inquiry
C01190-100UG 100 ug $528.00 Inquiry
The price does not include shipping fee and tax. Order Request Quote
Sequence: 
ADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA
 
UnitProt ID:
P10147

Source:
Escherichia coli

Affinity Tag:
His Tag (N-term)

Endotoxin Test:
<0.1 EU per 1 μg of the protein by the LAL method.

Activity:
Measure by its ability to chemoattract human PBMC using a concentration range of 5 -50 ng/mL.
 
Purity:
>95% as determined by SDS-PAGE.

Form:
Lyophilized

Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 200 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient redissolved.

Storage Buffer​:
Lyophilized from a 0.2 μm filtered solution of PBS, pH 8.0.

Stability & Storage​:
This product is stable after storage at:
• -20°C for 12 months in lyophilized state from date of receipt.
• -20°C or -80°C for 1 month under sterile conditions after reconstitution.
Avoid repeated freeze/thaw cycles.

Shipping Conditions:
Blue ice